Phone (+359) 877 398 024 / 10:00-17:00ч.
| Регистрация/Вход | Поръчка |
Можем да доставим този продукт, както до всяка точка на България, така и до всички други държави в Европа. За точна цена, срок за доставка и други условия, прочетете информация или изпратете запитване към нас ТУК!


IGF-1 LR3 (с включена бактериостатична вода) – 10 амп. х 1 мг.

Купи и спечели 549 промо точки!

Цена: 680 лв. Цена: 549 лв.

0 ревюта Напиши ревю

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding.

Категории: .
Вземи срещу 32940 промо точки
ПОРЪЧАЙ ТОЗИ ПРОДУКТ ВЕДНАГА,
САМО С 1 КЛИК
Не е нужна регистрация. Въведете само Вашия телефонен номер и ние ще се свържем с Вас за да уточним детайлите относно доставката.
*тази опция важи само за територията на България, за всички останали държави трябва да направите стандартна поръчка или да се свържете с нас чрез формата ни за запитвания

Ние Ви предлагаме:

доставка до 24 часа

напълно безплатна професионална консултация по всяко време

конкурентни цени

качествени и проверени продукти с официален произход

прозрачни и чисти условия, без малки букви и неясни клаузи, както и напълно реални промоции

Описание на продукта:

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecule exert fat metabolizing properties in addition with transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidences suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.

IGF1-LR3 Chemical Profile

CAS: 946870-92-4
Formula: C990H1528N262O300S7
Molecular weight: 9200
Peptide purity: > 99.0%
Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Отзиви

Все още няма отзиви за този продукт, желаете ли да дадете вашия?

Напишете отзив първи “IGF-1 LR3 (с включена бактериостатична вода) – 10 амп. х 1 мг.”

*

Полезни Статии

ноември 7, 2006

Ако напоследък сте подминавали спортните зали, това ще се отрази първо на корема ви. В тази област се намират четири ...

юни 19, 2015

В предишната статия стана въпрос за основните индивидуални фактори, от които зависи изграждането на правилната тренировъчна и хранителна стратегия. Тези фактори се ...

декември 7, 2006

В основата на двигателната активност и спортната дейност стои съкращаването на напречнонабраздената мускулатура. Енергията за това съкращение се получава от ...

ноември 23, 2010

Обикновената настинка е проклятието на традиционната медицина. Всеки човек настива, но медицината не знае как да се пребори с настинката. ...